![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
![]() | Protein Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB, C-terminal domain [419013] (1 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [419485] (1 PDB entry) Uniprot Q02062 |
![]() | Domain d1tqyb2: 1tqy B:247-403 [107248] Other proteins in same PDB: d1tqya1, d1tqya2, d1tqyb1, d1tqyc1, d1tqyc2, d1tqyd1, d1tqye1, d1tqye2, d1tqyf1, d1tqyg1, d1tqyg2, d1tqyh1 complexed with ace, mg, na |
PDB Entry: 1tqy (more details), 2 Å
SCOPe Domain Sequences for d1tqyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tqyb2 c.95.1.1 (B:247-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB, C-terminal domain {Streptomyces coelicolor [TaxId: 1902]} rhdaygelagcastfdpapgsgrpaglerairlalndagtgpedvdvvfadgagvpelda aearaigrvfgregvpvtvpktttgrlysgggpldvvtalmslregviaptagvtsvpre ygidlvlgeprstaprtalvlargrwgfnsaavlrrf
Timeline for d1tqyb2: