Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
Protein Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA, N-terminal domain [419010] (1 species) |
Species Streptomyces coelicolor [TaxId:1902] [419482] (1 PDB entry) Uniprot Q02059 |
Domain d1tqyc1: 1tqy C:3-257 [107249] Other proteins in same PDB: d1tqya2, d1tqyb1, d1tqyb2, d1tqyc2, d1tqyd1, d1tqyd2, d1tqye2, d1tqyf1, d1tqyf2, d1tqyg2, d1tqyh1, d1tqyh2 complexed with ace, mg, na has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1tqy (more details), 2 Å
SCOPe Domain Sequences for d1tqyc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tqyc1 c.95.1.1 (C:3-257) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA, N-terminal domain {Streptomyces coelicolor [TaxId: 1902]} rrvvitgvgvrapggngtrqfwelltsgrtatrrisffdpspyrsqvaaeadfdpvaegf gpreldrmdrasqfavacareafaasgldpdtldparvgvslgsavaaatslereyllls dsgrdwevdaawlsrhmfdylvpsvmpaevawavgaegpvtmvstgctsgldsvgnavra ieegsadvmfagaadtpitpivvacfdairattarnddpehasrpfdgtrdgfvlaegaa mfvledydsalarga
Timeline for d1tqyc1: