Lineage for d1tqyg1 (1tqy G:3-257)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916478Protein Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA, N-terminal domain [419010] (1 species)
  7. 2916479Species Streptomyces coelicolor [TaxId:1902] [419482] (1 PDB entry)
    Uniprot Q02059
  8. 2916483Domain d1tqyg1: 1tqy G:3-257 [107257]
    Other proteins in same PDB: d1tqya2, d1tqyb1, d1tqyb2, d1tqyc2, d1tqyd1, d1tqyd2, d1tqye2, d1tqyf1, d1tqyf2, d1tqyg2, d1tqyh1, d1tqyh2
    complexed with ace, mg, na
    has additional insertions and/or extensions that are not grouped together

Details for d1tqyg1

PDB Entry: 1tqy (more details), 2 Å

PDB Description: the actinorhodin ketosynthase/chain length factor
PDB Compounds: (G:) Actinorhodin polyketide putative beta-ketoacyl synthase 1

SCOPe Domain Sequences for d1tqyg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqyg1 c.95.1.1 (G:3-257) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA, N-terminal domain {Streptomyces coelicolor [TaxId: 1902]}
rrvvitgvgvrapggngtrqfwelltsgrtatrrisffdpspyrsqvaaeadfdpvaegf
gpreldrmdrasqfavacareafaasgldpdtldparvgvslgsavaaatslereyllls
dsgrdwevdaawlsrhmfdylvpsvmpaevawavgaegpvtmvstgctsgldsvgnavra
ieegsadvmfagaadtpitpivvacfdairattarnddpehasrpfdgtrdgfvlaegaa
mfvledydsalarga

SCOPe Domain Coordinates for d1tqyg1:

Click to download the PDB-style file with coordinates for d1tqyg1.
(The format of our PDB-style files is described here.)

Timeline for d1tqyg1: