SCOPe 2.08: Domain d1to4c1: 1to4 C:1-153

Lineage for d1to4c1 (1to4 C:1-153)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [110066] (2 PDB entries)
   Uniprot Q01137

8. Domain d1to4c1: 1to4 C:1-153 [107164]
   Other proteins in same PDB: d1to4a2, d1to4b2, d1to4c2, d1to4d2
   complexed with cu, zn

Details for d1to4c1

PDB Entry: 1to4, 1.55 Å

PDB Description: Structure of the cytosolic Cu,Zn SOD from S. mansoni

PDB Compounds: (C:) superoxide dismutase

SCOPe Domain Sequences for d1to4c1:

Sequence; same for both SEQRES and ATOM records:

>d1to4c1 b.1.8.1 (C:1-153) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
mkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngctsag
ahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmvihe
neddlgrgghelskvtgnaggrlacgvvglaae

Timeline for d1to4c1:

• d1to4c1 first appeared in SCOP 1.69, called d1to4c_
  
• d1to4c1 appears in SCOPe 2.07