PDB entry 1to4

View 1to4 on RCSB PDB site
Description: Structure of the cytosolic Cu,Zn SOD from S. mansoni
Class: oxidoreductase
Keywords: beta-barrel, OXIDOREDUCTASE
Deposited on 2004-06-12, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.158
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SOD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01137 (3-155)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1to4a1, d1to4a2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SOD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01137 (3-155)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1to4b1, d1to4b2
  • Chain 'C':
    Compound: superoxide dismutase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SOD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01137 (3-155)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1to4c1, d1to4c2
  • Chain 'D':
    Compound: superoxide dismutase
    Species: Schistosoma mansoni [TaxId:6183]
    Gene: SOD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01137 (3-155)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1to4d1, d1to4d2
  • Heterogens: CU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1to4A (A:)
    gsnmkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngct
    sagahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmv
    iheneddlgrgghelskvtgnaggrlacgvvglaae
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1to4B (B:)
    gsnmkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngct
    sagahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmv
    iheneddlgrgghelskvtgnaggrlacgvvglaae
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1to4C (C:)
    gsnmkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngct
    sagahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmv
    iheneddlgrgghelskvtgnaggrlacgvvglaae
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1to4D (D:)
    gsnmkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngct
    sagahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmv
    iheneddlgrgghelskvtgnaggrlacgvvglaae