Lineage for d1to4d1 (1to4 D:1-153)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [110066] (2 PDB entries)
    Uniprot Q01137
  8. Domain d1to4d1: 1to4 D:1-153 [107165]
    Other proteins in same PDB: d1to4a2, d1to4b2, d1to4c2, d1to4d2
    complexed with cu, zn

Details for d1to4d1

PDB Entry: 1to4 (more details), 1.55 Å

PDB Description: Structure of the cytosolic Cu,Zn SOD from S. mansoni
PDB Compounds: (D:) superoxide dismutase

SCOPe Domain Sequences for d1to4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1to4d1 b.1.8.1 (D:1-153) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
mkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngctsag
ahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmvihe
neddlgrgghelskvtgnaggrlacgvvglaae

SCOPe Domain Coordinates for d1to4d1 are not available.

Timeline for d1to4d1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1to4d2
View in 3D
Domains from other chains:
(mouse over for more information)
d1to4a1, d1to4a2, d1to4b1, d1to4b2, d1to4c1, d1to4c2