Lineage for d1to4c_ (1to4 C:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 455651Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
    has additional strand at N-terminus
  5. 455652Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 455665Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)
  7. 455694Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [110066] (2 PDB entries)
  8. 455697Domain d1to4c_: 1to4 C: [107164]

Details for d1to4c_

PDB Entry: 1to4 (more details), 1.55 Å

PDB Description: Structure of the cytosolic Cu,Zn SOD from S. mansoni

SCOP Domain Sequences for d1to4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1to4c_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Blood fluke (Schistosoma mansoni)}
gsnmkavcvmtgtagvkgvvkftqetdngpvhvhaefsglkagkhgfhvhefgdttngct
sagahfnptkqehgapedsirhvgdlgnvvagadgnavynatdklislngshsiigrsmv
iheneddlgrgghelskvtgnaggrlacgvvglaae

SCOP Domain Coordinates for d1to4c_:

Click to download the PDB-style file with coordinates for d1to4c_.
(The format of our PDB-style files is described here.)

Timeline for d1to4c_: