SCOP 1.71: Domain d1tjle1: 1tjl E:7-110

Lineage for d1tjle1 (1tjl E:7-110)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.2: Long alpha-hairpin [46556] (13 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.14: DnaK suppressor protein DksA, alpha-hairpin domain [109635] (1 family)

5. Family a.2.14.1: DnaK suppressor protein DksA, alpha-hairpin domain [109636] (1 protein)

6. Protein DnaK suppressor protein DksA, alpha-hairpin domain [109637] (1 species)

7. Species Escherichia coli [TaxId:562] [109638] (1 PDB entry)

8. Domain d1tjle1: 1tjl E:7-110 [107035]
   Other proteins in same PDB: d1tjla2, d1tjlb2, d1tjlc2, d1tjld2, d1tjle2, d1tjlf2, d1tjlg2, d1tjlh2, d1tjli2, d1tjlj2

Details for d1tjle1

PDB Entry: 1tjl, 2 Å

PDB Description: Crystal structure of transcription factor DksA from E. coli

SCOP Domain Sequences for d1tjle1:

Sequence; same for both SEQRES and ATOM records:

>d1tjle1 a.2.14.1 (E:7-110) DnaK suppressor protein DksA, alpha-hairpin domain {Escherichia coli}
rktsslsilaiagvepyqekpgeeymneaqlahfrrileawrnqlrdevdrtvthmqdea
anfpdpvdraaqeeefslelrnrdrerklikkiektlkkveded

Timeline for d1tjle1:

• d1tjle1 first appeared in SCOP 1.69
  
• d1tjle1 appears in SCOP 1.73
  
• d1tjle1 appears in the current release, SCOPe 2.08