Class g: Small proteins [56992] (79 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (14 families) |
Family g.39.1.13: Prokaryotic DksA/TraR C4-type zinc finger [111448] (1 protein) Pfam 01258; Pfam coverage extends to the second helix of the upstream alpha-hairpin domain |
Protein DnaK suppressor protein DksA, zinc finger domain [111449] (1 species) |
Species Escherichia coli [TaxId:562] [111450] (1 PDB entry) |
Domain d1tjle2: 1tjl E:111-151 [107036] Other proteins in same PDB: d1tjla1, d1tjlb1, d1tjlc1, d1tjld1, d1tjle1, d1tjlf1, d1tjlg1, d1tjlh1, d1tjli1, d1tjlj1 |
PDB Entry: 1tjl (more details), 2 Å
SCOP Domain Sequences for d1tjle2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tjle2 g.39.1.13 (E:111-151) DnaK suppressor protein DksA, zinc finger domain {Escherichia coli} fgycescgveigirrlearptadlcidcktlaeirekqmag
Timeline for d1tjle2: