Lineage for d1tjlh2 (1tjl H:111-151)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624310Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 624311Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (14 families) (S)
  5. 624548Family g.39.1.13: Prokaryotic DksA/TraR C4-type zinc finger [111448] (1 protein)
    Pfam 01258; Pfam coverage extends to the second helix of the upstream alpha-hairpin domain
  6. 624549Protein DnaK suppressor protein DksA, zinc finger domain [111449] (1 species)
  7. 624550Species Escherichia coli [TaxId:562] [111450] (1 PDB entry)
  8. 624558Domain d1tjlh2: 1tjl H:111-151 [107042]
    Other proteins in same PDB: d1tjla1, d1tjlb1, d1tjlc1, d1tjld1, d1tjle1, d1tjlf1, d1tjlg1, d1tjlh1, d1tjli1, d1tjlj1

Details for d1tjlh2

PDB Entry: 1tjl (more details), 2 Å

PDB Description: Crystal structure of transcription factor DksA from E. coli

SCOP Domain Sequences for d1tjlh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjlh2 g.39.1.13 (H:111-151) DnaK suppressor protein DksA, zinc finger domain {Escherichia coli}
fgycescgveigirrlearptadlcidcktlaeirekqmag

SCOP Domain Coordinates for d1tjlh2:

Click to download the PDB-style file with coordinates for d1tjlh2.
(The format of our PDB-style files is described here.)

Timeline for d1tjlh2: