Lineage for d1tjka_ (1tjk A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. Protein Snake phospholipase A2 [48624] (38 species)
  7. Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (39 PDB entries)
    Uniprot P59071
  8. Domain d1tjka_: 1tjk A: [107026]
    complexed with so4

Details for d1tjka_

PDB Entry: 1tjk (more details), 1.25 Å

PDB Description: crystal structure of the complex formed between group ii phospholipase a2 with a designed pentapeptide, phe- leu- ser- thr- lys at 1.2 a resolution
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1tjka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjka_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggsgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d1tjka_ are not available.

Timeline for d1tjka_: