PDB entry 1tjk

View 1tjk on RCSB PDB site
Description: Crystal structure of the complex formed between group II phospholipase A2 with a designed pentapeptide, Phe- Leu- Ser- Thr- Lys at 1.2 A resolution
Class: hydrolase
Keywords: Phospholipase A2, Enzyme, Complex, HYDROLASE
Deposited on 2004-06-06, released 2004-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Daboia russellii pulchella [TaxId:97228]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59071 (0-120)
    • conflict (32)
  Domains in SCOPe 2.08: d1tjka_
• Chain 'I':
  Compound: synthetic peptide
  Database cross-references and differences (RAF-indexed):
  • PDB 1TJK (0-4)
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tjkA (A:)
  sllefgkmileetgklaipsyssygcycgwggsgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c
  

  
  
• Chain 'I':
  No sequence available.