Lineage for d1tiqa_ (1tiq A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731259Protein Protease synthase and sporulation negative regulatory protein PaiA [111100] (1 species)
  7. 731260Species Bacillus subtilis [TaxId:1423] [111101] (1 PDB entry)
  8. 731261Domain d1tiqa_: 1tiq A: [107010]

Details for d1tiqa_

PDB Entry: 1tiq (more details), 1.9 Å

PDB Description: crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64.
PDB Compounds: (A:) Protease synthase and sporulation negative regulatory protein PAI 1

SCOP Domain Sequences for d1tiqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]}
svkmkkcsredlqtlqqlsietfndtfkeqnspenmkaylesafnteqlekelsnmssqf
ffiyfdheiagyvkvniddaqseemgaesleieriyiknsfqkhglgkhllnkaieiale
rnkkniwlgvweknenaiafykkmgfvqtgahsfymgdeeqtdlimaktlile

SCOP Domain Coordinates for d1tiqa_:

Click to download the PDB-style file with coordinates for d1tiqa_.
(The format of our PDB-style files is described here.)

Timeline for d1tiqa_: