| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
| Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
| Protein Protease synthase and sporulation negative regulatory protein PaiA [111100] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [111101] (1 PDB entry) Uniprot P21340 |
| Domain d1tiqa1: 1tiq A:2-172 [107010] Other proteins in same PDB: d1tiqa2, d1tiqb2 Structural genomics target complexed with coa, dtt, so4 |
PDB Entry: 1tiq (more details), 1.9 Å
SCOPe Domain Sequences for d1tiqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tiqa1 d.108.1.1 (A:2-172) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]}
svkmkkcsredlqtlqqlsietfndtfkeqnspenmkaylesafnteqlekelsnmssqf
ffiyfdheiagyvkvniddaqseemgaesleieriyiknsfqkhglgkhllnkaieiale
rnkkniwlgvweknenaiafykkmgfvqtgahsfymgdeeqtdlimaktli
Timeline for d1tiqa1: