SCOPe 2.07: Domain d1tidc_: 1tid C:

Lineage for d1tidc_ (1tid C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.3: Histidine kinase [55884] (8 proteins)

6. Protein Anti-sigma factor spoIIab [75535] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [75536] (5 PDB entries)
   Uniprot O32727

8. Domain d1tidc_: 1tid C: [107001]
   Other proteins in same PDB: d1tidb1, d1tidb2, d1tidd1, d1tidd2
   complexed with atp, mg

Details for d1tidc_

PDB Entry: 1tid, 2.5 Å

PDB Description: crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: poised for phosphorylation complex with atp, crystal form i

PDB Compounds: (C:) Anti-sigma F factor

SCOPe Domain Sequences for d1tidc_:

Sequence; same for both SEQRES and ATOM records:

>d1tidc_ d.122.1.3 (C:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]}
nemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndpng
ivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdeviv
esevnkgttvylkk

Timeline for d1tidc_:

• d1tidc_ first appeared in SCOP 1.69
  
• d1tidc_ appears in SCOPe 2.06
  
• d1tidc_ appears in the current release, SCOPe 2.08