SCOPe 2.08: Domain d1tgea1: 1tge A:298-395

Lineage for d1tgea1 (1tge A:298-395)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.18: E set domains [81296] (27 families)
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
Protein Envelope glycoprotein [49213] (5 species)
Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries)
Uniprot P12823 281-675 # 99% sequence identity
Domain d1tgea1: 1tge A:298-395 [106894]
Other proteins in same PDB: d1tgea2, d1tgeb2, d1tgec2

Details for d1tgea1

PDB Description: the structure of immature dengue virus at 12.5 angstrom

PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d1tgea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tgea1 b.1.18.4 (A:298-395) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkkg

SCOPe Domain Coordinates for d1tgea1:

Click to download the PDB-style file with coordinates for d1tgea1.
(The format of our PDB-style files is described here.)

Timeline for d1tgea1: