PDB entry 1tge

View 1tge on RCSB PDB site
Description: The structure of immature Dengue virus at 12.5 angstrom
Class: Virus
Keywords: flavivirus, dengue immature virus, prM particle, Icosahedral virus
Deposited on 2004-05-28, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-06.
Experiment type: EM
Resolution: 12.5 Å
R-factor: N/A
AEROSPACI score: -0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope glycoprotein
    Species: Dengue virus 2 Puerto Rico/PR159-S1/1969 [TaxId:11066]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27914 (0-394)
      • conflict (70)
      • conflict (389)
    Domains in SCOPe 2.07: d1tgea1, d1tgea2
  • Chain 'B':
    Compound: Envelope glycoprotein
    Species: Dengue virus 2 Puerto Rico/PR159-S1/1969 [TaxId:11066]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27914 (0-394)
      • conflict (70)
      • conflict (389)
    Domains in SCOPe 2.07: d1tgeb1, d1tgeb2
  • Chain 'C':
    Compound: Envelope glycoprotein
    Species: Dengue virus 2 Puerto Rico/PR159-S1/1969 [TaxId:11066]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27914 (0-394)
      • conflict (70)
      • conflict (389)
    Domains in SCOPe 2.07: d1tgec1, d1tgec2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tgeA (A:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
    ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
    vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
    knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsys
    mctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivte
    kdspvnieaeppfgdsyiiigvepgqlklnwfkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tgeA (A:)
    mrcigisnrdfvegvsswvdivlehgscvttmaknkptldfelikteakqpatlrkycie
    akltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamftck
    knmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygtvt
    mecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgagsnwiqketlvtfknpha
    kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsysmctgk
    fkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivtekdspv
    nieaeppfgdsyiiigvepgqlklnwfkkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tgeB (B:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
    ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
    vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
    knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsys
    mctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivte
    kdspvnieaeppfgdsyiiigvepgqlklnwfkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tgeB (B:)
    mrcigisnrdfvegvsswvdivlehgscvttmaknkptldfelikteakqpatlrkycie
    akltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamftck
    knmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygtvt
    mecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgagsnwiqketlvtfknpha
    kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsysmctgk
    fkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivtekdspv
    nieaeppfgdsyiiigvepgqlklnwfkkg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tgeC (C:)
    mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
    ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
    ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
    vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
    knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsys
    mctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivte
    kdspvnieaeppfgdsyiiigvepgqlklnwfkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tgeC (C:)
    mrcigisnrdfvegvsswvdivlehgscvttmaknkptldfelikteakqpatlrkycie
    akltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamftck
    knmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygtvt
    mecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgagsnwiqketlvtfknpha
    kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgmsysmctgk
    fkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpivtekdspv
    nieaeppfgdsyiiigvepgqlklnwfkkg