SCOPe 2.08: Domain d1tf1d1: 1tf1 D:12-183

Lineage for d1tf1d1 (1tf1 D:12-183)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins)
   Pfam PF01614

6. Protein Transcriptional regulator AllR, C-terminal domain [111113] (1 species)

7. Species Escherichia coli [TaxId:562] [111114] (1 PDB entry)
   Uniprot P77734 97-269

8. Domain d1tf1d1: 1tf1 D:12-183 [106829]
   Other proteins in same PDB: d1tf1a2, d1tf1b2, d1tf1c2, d1tf1d2
   Structural genomics target

Details for d1tf1d1

PDB Entry: 1tf1, 1.8 Å

PDB Description: crystal structure of the e. coli glyoxylate regulatory protein ligand binding domain

PDB Compounds: (D:) Negative regulator of allantoin and glyoxylate utilization operons

SCOPe Domain Sequences for d1tf1d1:

Sequence; same for both SEQRES and ATOM records:

>d1tf1d1 d.110.2.2 (D:12-183) Transcriptional regulator AllR, C-terminal domain {Escherichia coli [TaxId: 562]}
dvlsvagpfmrrlmllsgetvnvairngneavligqlecksmvrmcaplgsrlplhasga
gkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgytvdkeehvvgln
ciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistalglk

Timeline for d1tf1d1:

• d1tf1d1 first appeared in SCOP 1.69, called d1tf1d_
  
• d1tf1d1 appears in SCOPe 2.07