Lineage for d1tf1c1 (1tf1 C:12-183)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. Family d.110.2.2: IclR ligand-binding domain-like [75513] (2 proteins)
    Pfam PF01614
  6. Protein Transcriptional regulator AllR, C-terminal domain [111113] (1 species)
  7. Species Escherichia coli [TaxId:562] [111114] (1 PDB entry)
    Uniprot P77734 97-269
  8. Domain d1tf1c1: 1tf1 C:12-183 [106828]
    Other proteins in same PDB: d1tf1a2, d1tf1b2, d1tf1c2, d1tf1d2
    Structural genomics target

Details for d1tf1c1

PDB Entry: 1tf1 (more details), 1.8 Å

PDB Description: crystal structure of the e. coli glyoxylate regulatory protein ligand binding domain
PDB Compounds: (C:) Negative regulator of allantoin and glyoxylate utilization operons

SCOPe Domain Sequences for d1tf1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tf1c1 d.110.2.2 (C:12-183) Transcriptional regulator AllR, C-terminal domain {Escherichia coli [TaxId: 562]}
dvlsvagpfmrrlmllsgetvnvairngneavligqlecksmvrmcaplgsrlplhasga
gkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgytvdkeehvvgln
ciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistalglk

SCOPe Domain Coordinates for d1tf1c1 are not available.

Timeline for d1tf1c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tf1c2
View in 3D
Domains from other chains:
(mouse over for more information)
d1tf1a1, d1tf1a2, d1tf1b1, d1tf1b2, d1tf1d1, d1tf1d2