PDB entry 1tf1

View 1tf1 on RCSB PDB site
Description: Crystal Structure of the E. coli Glyoxylate Regulatory Protein Ligand Binding Domain
Class: transcription
Keywords: Midwest Center for Structural Genomics, GlcR, ligand binding domain, transcriptional regulator, PSI, Protein Structure Initiative, MCSG, TRANSCRIPTION
Deposited on 2004-05-26, released 2004-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Negative regulator of allantoin and glyoxylate utilization operons
    Species: Escherichia coli [TaxId:562]
    Gene: glxa3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACN4 (23-End)
      • cloning artifact (12-22)
    Domains in SCOPe 2.08: d1tf1a1, d1tf1a2
  • Chain 'B':
    Compound: Negative regulator of allantoin and glyoxylate utilization operons
    Species: Escherichia coli [TaxId:562]
    Gene: glxa3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACN4 (23-End)
      • cloning artifact (17-22)
    Domains in SCOPe 2.08: d1tf1b1, d1tf1b2
  • Chain 'C':
    Compound: Negative regulator of allantoin and glyoxylate utilization operons
    Species: Escherichia coli [TaxId:562]
    Gene: glxa3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACN4 (23-End)
      • cloning artifact (16-22)
    Domains in SCOPe 2.08: d1tf1c1, d1tf1c2
  • Chain 'D':
    Compound: Negative regulator of allantoin and glyoxylate utilization operons
    Species: Escherichia coli [TaxId:562]
    Gene: glxa3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACN4 (23-End)
      • cloning artifact (12-22)
    Domains in SCOPe 2.08: d1tf1d1, d1tf1d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tf1A (A:)
    mgsshhhhhhssgrenlyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligql
    ecksmvrmcaplgsrlplhasgagkallyplaeeelmsiilqtglqqftpttlvdmptll
    kdleqarelgytvdkeehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgel
    vrdtardistalglkahp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tf1A (A:)
    grenlyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligqlecksmvrmcapl
    gsrlplhasgagkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgyt
    vdkeehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistal
    glka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tf1B (B:)
    mgsshhhhhhssgrenlyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligql
    ecksmvrmcaplgsrlplhasgagkallyplaeeelmsiilqtglqqftpttlvdmptll
    kdleqarelgytvdkeehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgel
    vrdtardistalglkahp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tf1B (B:)
    yfqghmdvlsvagpfmrrlmllsgetvnvairngneavligqlecksmvrmcaplgsrlp
    lhasgagkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgytvdkee
    hvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistalglk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tf1C (C:)
    mgsshhhhhhssgrenlyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligql
    ecksmvrmcaplgsrlplhasgagkallyplaeeelmsiilqtglqqftpttlvdmptll
    kdleqarelgytvdkeehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgel
    vrdtardistalglkahp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tf1C (C:)
    lyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligqlecksmvrmcaplgsrl
    plhasgagkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgytvdke
    ehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistalglk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tf1D (D:)
    mgsshhhhhhssgrenlyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligql
    ecksmvrmcaplgsrlplhasgagkallyplaeeelmsiilqtglqqftpttlvdmptll
    kdleqarelgytvdkeehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgel
    vrdtardistalglkahp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tf1D (D:)
    grenlyfqghmdvlsvagpfmrrlmllsgetvnvairngneavligqlecksmvrmcapl
    gsrlplhasgagkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgyt
    vdkeehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistal
    glk