Lineage for d1texc_ (1tex C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109901Family c.37.1.5: PAPS sulfotransferase [52575] (15 protein domains)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2109972Protein Stf0 sulfotransferase [110530] (1 species)
  7. 2109973Species Mycobacterium smegmatis [TaxId:1772] [110531] (1 PDB entry)
    Uniprot P84151
  8. 2109976Domain d1texc_: 1tex C: [106820]
    complexed with tre

Details for d1texc_

PDB Entry: 1tex (more details), 2.6 Å

PDB Description: Mycobacterium smegmatis Stf0 Sulfotransferase with Trehalose
PDB Compounds: (C:) Stf0 Sulfotransferase

SCOPe Domain Sequences for d1texc_:

Sequence, based on SEQRES records: (download)

>d1texc_ c.37.1.5 (C:) Stf0 sulfotransferase {Mycobacterium smegmatis [TaxId: 1772]}
hptaylvlasqrsgstllveslratgvagepqeffqylpntsmspqprewfadvedqsil
rlldpliegkpdlapatiwrdyiqtvgrtpngvwggklmwnqtpllvqrakdlpdrsgsg
llsairdvvgsdpvlihihrpdvvsqavsfwravqtrvwrgrpdpvrdaraeyhagaiah
vitmlraqeegwrawfteenvepidvdypylwrnltevvgtvlealgqdprlapkpvler
qadqrsdewveryrrdaqrdglpl

Sequence, based on observed residues (ATOM records): (download)

>d1texc_ c.37.1.5 (C:) Stf0 sulfotransferase {Mycobacterium smegmatis [TaxId: 1772]}
hptaylvlasqrsgstllveslratgvagepqeffqylpntsmspqprewfadvedqsil
rlldpliegkpdlapatiwrdyiqtvgrtpngvwggklmwnqtpllvqrakdlpdrsgsg
llsairdvvgsdpvlihihrpdvvsqavsfwravqtrvwraeyhagaiahvitmlraqee
gwrawfteenvepidvdypylwrnltevvgtvlealgqdprlapkpdewveryrrdaqrd
glpl

SCOPe Domain Coordinates for d1texc_:

Click to download the PDB-style file with coordinates for d1texc_.
(The format of our PDB-style files is described here.)

Timeline for d1texc_: