PDB entry 1tex

View 1tex on RCSB PDB site
Description: Mycobacterium smegmatis Stf0 Sulfotransferase with Trehalose
Class: transferase
Keywords: mycobacterium, sulfotransferase, sulfolipid, sulfation, trehalose, trehalose-2-sulfate, TRANSFERASE
Deposited on 2004-05-25, released 2004-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stf0 Sulfotransferase
    Species: Mycobacterium smegmatis [TaxId:1772]
    Gene: stf0
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1texa_
  • Chain 'B':
    Compound: Stf0 Sulfotransferase
    Species: Mycobacterium smegmatis [TaxId:1772]
    Gene: stf0
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1texb_
  • Chain 'C':
    Compound: Stf0 Sulfotransferase
    Species: Mycobacterium smegmatis [TaxId:1772]
    Gene: stf0
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1texc_
  • Chain 'D':
    Compound: Stf0 Sulfotransferase
    Species: Mycobacterium smegmatis [TaxId:1772]
    Gene: stf0
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1texd_
  • Heterogens: TRE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1texA (A:)
    mgsshhhhhhssglvprgshmsdhptaylvlasqrsgstllveslratgvagepqeffqy
    lpntsmspqprewfadvedqsilrlldpliegkpdlapatiwrdyiqtvgrtpngvwggk
    lmwnqtpllvqrakdlpdrsgsgllsairdvvgsdpvlihihrpdvvsqavsfwravqtr
    vwrgrpdpvrdaraeyhagaiahvitmlraqeegwrawfteenvepidvdypylwrnlte
    vvgtvlealgqdprlapkpvlerqadqrsdewveryrrdaqrdglpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1texA (A:)
    dhptaylvlasqrsgstllveslratgvagepqeffqylpntsmspqprewfadedqsil
    rlldpliegkpdlapatiwrdyiqtvgrtpngvwggklmwnqtpllvqrakdlpdrsgsg
    llsairdvvgsdpvlihihrpdvvsqavsfwravqtrvwrraeyhagaiahvitmlraqe
    egwrawfteenvepidvdypylwrnltevvgtvlealgqdprlaewveryrdqrdglpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1texB (B:)
    mgsshhhhhhssglvprgshmsdhptaylvlasqrsgstllveslratgvagepqeffqy
    lpntsmspqprewfadvedqsilrlldpliegkpdlapatiwrdyiqtvgrtpngvwggk
    lmwnqtpllvqrakdlpdrsgsgllsairdvvgsdpvlihihrpdvvsqavsfwravqtr
    vwrgrpdpvrdaraeyhagaiahvitmlraqeegwrawfteenvepidvdypylwrnlte
    vvgtvlealgqdprlapkpvlerqadqrsdewveryrrdaqrdglpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1texB (B:)
    hptaylvlasqrsgstllveslratgvagepqeffqylpntsmspqprewfadvedqsil
    rlldpliegkpdlapatiwrdyiqtvgrtpngvwggklmwnqtpllvqrakdlpdrsgsg
    llsairdvvgsdpvlihihrpdvvsqavsfwravqtrvwrdaraeyhagaiahvitmlra
    qeegwrawfteenvepidvdypylwrnltevvgtvlealgqdprlapkrsdewveryrrd
    lpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1texC (C:)
    mgsshhhhhhssglvprgshmsdhptaylvlasqrsgstllveslratgvagepqeffqy
    lpntsmspqprewfadvedqsilrlldpliegkpdlapatiwrdyiqtvgrtpngvwggk
    lmwnqtpllvqrakdlpdrsgsgllsairdvvgsdpvlihihrpdvvsqavsfwravqtr
    vwrgrpdpvrdaraeyhagaiahvitmlraqeegwrawfteenvepidvdypylwrnlte
    vvgtvlealgqdprlapkpvlerqadqrsdewveryrrdaqrdglpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1texC (C:)
    hptaylvlasqrsgstllveslratgvagepqeffqylpntsmspqprewfadvedqsil
    rlldpliegkpdlapatiwrdyiqtvgrtpngvwggklmwnqtpllvqrakdlpdrsgsg
    llsairdvvgsdpvlihihrpdvvsqavsfwravqtrvwraeyhagaiahvitmlraqee
    gwrawfteenvepidvdypylwrnltevvgtvlealgqdprlapkpdewveryrrdaqrd
    glpl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1texD (D:)
    mgsshhhhhhssglvprgshmsdhptaylvlasqrsgstllveslratgvagepqeffqy
    lpntsmspqprewfadvedqsilrlldpliegkpdlapatiwrdyiqtvgrtpngvwggk
    lmwnqtpllvqrakdlpdrsgsgllsairdvvgsdpvlihihrpdvvsqavsfwravqtr
    vwrgrpdpvrdaraeyhagaiahvitmlraqeegwrawfteenvepidvdypylwrnlte
    vvgtvlealgqdprlapkpvlerqadqrsdewveryrrdaqrdglpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1texD (D:)
    dhptaylvlasqrsgstllveslratgvagepqeffqylpntsmspqprewfadvedqsi
    lrlldpliegkpdlapatiwrdyiqtvgrtpngvwggklmwnqtpllvqrakdlpdrsgs
    gllsairdvvgsdpvlihihrpdvvsqavsfwravqtrvwrgaeyhagaiahvitmlraq
    eegwrawfteenvepidvdypylwrnltevvgtvlealgqdprlapkpsdewveryrrda
    qrdglpl