Lineage for d1texc_ (1tex C:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484015Family c.37.1.5: PAPS sulfotransferase [52575] (12 proteins)
    Pfam 00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 484072Protein Stf0 sulfotransferase [110530] (1 species)
  7. 484073Species Mycobacterium smegmatis [TaxId:1772] [110531] (1 PDB entry)
  8. 484076Domain d1texc_: 1tex C: [106820]

Details for d1texc_

PDB Entry: 1tex (more details), 2.6 Å

PDB Description: mycobacterium smegmatis stf0 sulfotransferase with trehalose

SCOP Domain Sequences for d1texc_:

Sequence, based on SEQRES records: (download)

>d1texc_ c.37.1.5 (C:) Stf0 sulfotransferase {Mycobacterium smegmatis}
hptaylvlasqrsgstllveslratgvagepqeffqylpntsmspqprewfadvedqsil
rlldpliegkpdlapatiwrdyiqtvgrtpngvwggklmwnqtpllvqrakdlpdrsgsg
llsairdvvgsdpvlihihrpdvvsqavsfwravqtrvwrgrpdpvrdaraeyhagaiah
vitmlraqeegwrawfteenvepidvdypylwrnltevvgtvlealgqdprlapkpvler
qadqrsdewveryrrdaqrdglpl

Sequence, based on observed residues (ATOM records): (download)

>d1texc_ c.37.1.5 (C:) Stf0 sulfotransferase {Mycobacterium smegmatis}
hptaylvlasqrsgstllveslratgvagepqeffqylpntsmspqprewfadvedqsil
rlldpliegkpdlapatiwrdyiqtvgrtpngvwggklmwnqtpllvqrakdlpdrsgsg
llsairdvvgsdpvlihihrpdvvsqavsfwravqtrvwraeyhagaiahvitmlraqee
gwrawfteenvepidvdypylwrnltevvgtvlealgqdprlapkpdewveryrrdaqrd
glpl

SCOP Domain Coordinates for d1texc_:

Click to download the PDB-style file with coordinates for d1texc_.
(The format of our PDB-style files is described here.)

Timeline for d1texc_: