Lineage for d1td2b_ (1td2 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1618889Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1618890Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1619064Family c.72.1.5: PfkB-like kinase [82515] (3 proteins)
    includes a variety of carbohydrate and pyrimidine kinases
  6. 1619085Protein Pyridoxamine kinase [102638] (1 species)
  7. 1619086Species Escherichia coli [TaxId:562] [102639] (2 PDB entries)
    Uniprot P77150
  8. 1619092Domain d1td2b_: 1td2 B: [106766]
    complexed with pxl, so4

Details for d1td2b_

PDB Entry: 1td2 (more details), 2.22 Å

PDB Description: Crystal Structure of the PdxY Protein from Escherichia coli
PDB Compounds: (B:) Pyridoxamine kinase

SCOPe Domain Sequences for d1td2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1td2b_ c.72.1.5 (B:) Pyridoxamine kinase {Escherichia coli [TaxId: 562]}
mmknilaiqshvvyghagnsaaefpmrrlganvwplntvqfsnhtqygkwtgcvmppshl
teivqgiaaidklhtcdavlsgylgsaeqgehilgivrqvkaanpqakyfcdpvmghpek
gcivapgvaefhvrhglpasdiiapnlveleilcehavnnveeavlaareliaqgpqivl
vkhlaragysrdrfemllvtadeawhisrplvdfgmrqpvgvgdvtsglllvkllqgatl
qealehvtaavyeimvttkamqeyelqvvaaqdriakpehyfsatkl

SCOPe Domain Coordinates for d1td2b_:

Click to download the PDB-style file with coordinates for d1td2b_.
(The format of our PDB-style files is described here.)

Timeline for d1td2b_: