Lineage for d1td2b_ (1td2 B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 492652Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 492653Superfamily c.72.1: Ribokinase-like [53613] (5 families) (S)
    has extra strand located between strands 2 and 3
  5. 492749Family c.72.1.5: PfkB-like kinase [82515] (2 proteins)
    includes a variety of carbohydrate and pyrimidine kinases
  6. 492767Protein Pyridoxamine kinase [102638] (1 species)
  7. 492768Species Escherichia coli [TaxId:562] [102639] (2 PDB entries)
  8. 492774Domain d1td2b_: 1td2 B: [106766]

Details for d1td2b_

PDB Entry: 1td2 (more details), 2.22 Å

PDB Description: Crystal Structure of the PdxY Protein from Escherichia coli

SCOP Domain Sequences for d1td2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1td2b_ c.72.1.5 (B:) Pyridoxamine kinase {Escherichia coli}
mmknilaiqshvvyghagnsaaefpmrrlganvwplntvqfsnhtqygkwtgcvmppshl
teivqgiaaidklhtcdavlsgylgsaeqgehilgivrqvkaanpqakyfcdpvmghpek
gcivapgvaefhvrhglpasdiiapnlveleilcehavnnveeavlaareliaqgpqivl
vkhlaragysrdrfemllvtadeawhisrplvdfgmrqpvgvgdvtsglllvkllqgatl
qealehvtaavyeimvttkamqeyelqvvaaqdriakpehyfsatkl

SCOP Domain Coordinates for d1td2b_:

Click to download the PDB-style file with coordinates for d1td2b_.
(The format of our PDB-style files is described here.)

Timeline for d1td2b_: