SCOPe 2.05: Domain d1td2b_: 1td2 B:

Lineage for d1td2b_ (1td2 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.5: PfkB-like kinase [82515] (3 proteins)
   includes a variety of carbohydrate and pyrimidine kinases

6. Protein Pyridoxamine kinase [102638] (1 species)

7. Species Escherichia coli [TaxId:562] [102639] (2 PDB entries)
   Uniprot P77150

8. Domain d1td2b_: 1td2 B: [106766]
   complexed with pxl, so4

Details for d1td2b_

PDB Entry: 1td2, 2.22 Å

PDB Description: Crystal Structure of the PdxY Protein from Escherichia coli

PDB Compounds: (B:) Pyridoxamine kinase

SCOPe Domain Sequences for d1td2b_:

Sequence; same for both SEQRES and ATOM records:

>d1td2b_ c.72.1.5 (B:) Pyridoxamine kinase {Escherichia coli [TaxId: 562]}
mmknilaiqshvvyghagnsaaefpmrrlganvwplntvqfsnhtqygkwtgcvmppshl
teivqgiaaidklhtcdavlsgylgsaeqgehilgivrqvkaanpqakyfcdpvmghpek
gcivapgvaefhvrhglpasdiiapnlveleilcehavnnveeavlaareliaqgpqivl
vkhlaragysrdrfemllvtadeawhisrplvdfgmrqpvgvgdvtsglllvkllqgatl
qealehvtaavyeimvttkamqeyelqvvaaqdriakpehyfsatkl

Timeline for d1td2b_:

• d1td2b_ first appeared in SCOP 1.69
  
• d1td2b_ appears in SCOPe 2.04
  
• d1td2b_ appears in SCOPe 2.06
  
• d1td2b_ appears in the current release, SCOPe 2.08