Lineage for d1t7sa_ (1t7s A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696764Superfamily a.7.7: BAG domain [63491] (1 family) (S)
  5. 2696765Family a.7.7.1: BAG domain [63492] (4 proteins)
    Pfam PF02179
    this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain
  6. 2696766Protein BAG-family molecular chaperon regulator-1, BAG1 [63493] (3 species)
  7. 2696778Species Nematode (Caenorhabditis elegans) [TaxId:6239] [109744] (1 PDB entry)
    Uniprot O44739 74-210
  8. 2696779Domain d1t7sa_: 1t7s A: [106636]
    Structural genomics target
    in the crystal, there is a tetramer made two helix-swapped dimers with an unusual beta-sheet interface

    has additional insertions and/or extensions that are not grouped together

Details for d1t7sa_

PDB Entry: 1t7s (more details), 2.8 Å

PDB Description: Structural Genomics of Caenorhabditis elegans: Structure of BAG-1 protein
PDB Compounds: (A:) BAG-1 cochaperone

SCOPe Domain Sequences for d1t7sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t7sa_ a.7.7.1 (A:) BAG-family molecular chaperon regulator-1, BAG1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
dkiivmggknalvddagfkmlmqyekhnlsnlqkaydlnlrdvadlergflekpkqvemg
kklekkvkyfneeaerhletldgmniitettpenqakrnrekrktlvngiqtllnqndal
lrrlqeyqs

SCOPe Domain Coordinates for d1t7sa_:

Click to download the PDB-style file with coordinates for d1t7sa_.
(The format of our PDB-style files is described here.)

Timeline for d1t7sa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1t7sb_