PDB entry 1t7s

View 1t7s on RCSB PDB site
Description: Structural Genomics of Caenorhabditis elegans: Structure of BAG-1 protein
Class: chaperone
Keywords: Structural genomics, BAG-1 cochaperone, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG
Deposited on 2004-05-10, released 2004-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BAG-1 cochaperone
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: Bag-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O44739 (0-End)
      • modified residue (5)
      • modified residue (19)
      • modified residue (21)
      • modified residue (58)
      • modified residue (83)
    Domains in SCOPe 2.08: d1t7sa_
  • Chain 'B':
    Compound: BAG-1 cochaperone
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: Bag-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O44739 (0-End)
      • modified residue (5)
      • modified residue (19)
      • modified residue (21)
      • modified residue (58)
      • modified residue (83)
    Domains in SCOPe 2.08: d1t7sb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t7sA (A:)
    dkiivmggknalvddagfkmlmqyekhnlsnlqkaydlnlrdvadlergflekpkqvemg
    kklekkvkyfneeaerhletldgmniitettpenqakrnrekrktlvngiqtllnqndal
    lrrlqeyqsvlngdipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t7sA (A:)
    dkiivmggknalvddagfkmlmqyekhnlsnlqkaydlnlrdvadlergflekpkqvemg
    kklekkvkyfneeaerhletldgmniitettpenqakrnrekrktlvngiqtllnqndal
    lrrlqeyqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t7sB (B:)
    dkiivmggknalvddagfkmlmqyekhnlsnlqkaydlnlrdvadlergflekpkqvemg
    kklekkvkyfneeaerhletldgmniitettpenqakrnrekrktlvngiqtllnqndal
    lrrlqeyqsvlngdipe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t7sB (B:)
    dkiivmggknalvddagfkmlmqyekhnlsnlqkaydlnlrdvadlergflekpkqvemg
    kklekkvkyfneeaerhletldgmniitettpenqakrnrekrktlvngiqtllnqndal
    lrrlqeyqs