SCOPe 2.07: Domain d1t7sa_: 1t7s A:

Lineage for d1t7sa_ (1t7s A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.7: BAG domain [63491] (1 family)

5. Family a.7.7.1: BAG domain [63492] (4 proteins)
   Pfam PF02179
   this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain

6. Protein BAG-family molecular chaperon regulator-1, BAG1 [63493] (3 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [109744] (1 PDB entry)
   Uniprot O44739 74-210

8. Domain d1t7sa_: 1t7s A: [106636]
   Structural genomics target
   in the crystal, there is a tetramer made two helix-swapped dimers with an unusual beta-sheet interface

Details for d1t7sa_

PDB Entry: 1t7s, 2.8 Å

PDB Description: Structural Genomics of Caenorhabditis elegans: Structure of BAG-1 protein

PDB Compounds: (A:) BAG-1 cochaperone

SCOPe Domain Sequences for d1t7sa_:

Sequence; same for both SEQRES and ATOM records:

>d1t7sa_ a.7.7.1 (A:) BAG-family molecular chaperon regulator-1, BAG1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
dkiivmggknalvddagfkmlmqyekhnlsnlqkaydlnlrdvadlergflekpkqvemg
kklekkvkyfneeaerhletldgmniitettpenqakrnrekrktlvngiqtllnqndal
lrrlqeyqs

Timeline for d1t7sa_:

• d1t7sa_ first appeared in SCOP 1.69
  
• d1t7sa_ appears in SCOPe 2.06
  
• d1t7sa_ appears in the current release, SCOPe 2.08