Lineage for d1t6by_ (1t6b Y:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1611341Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1611342Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 1611343Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 1611344Protein Capillary morphogenesis protein 2 domain [102543] (1 species)
    Anthrax toxin receptor 2
  7. 1611345Species Human (Homo sapiens) [TaxId:9606] [102544] (3 PDB entries)
    Uniprot P58335 41-210
  8. 1611348Domain d1t6by_: 1t6b Y: [106557]
    Other proteins in same PDB: d1t6bx1, d1t6bx2
    complexed with ca, mn, na, pg4

Details for d1t6by_

PDB Entry: 1t6b (more details), 2.5 Å

PDB Description: Crystal structure of B. anthracis Protective Antigen complexed with human Anthrax toxin receptor
PDB Compounds: (Y:) Anthrax toxin receptor 2

SCOPe Domain Sequences for d1t6by_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6by_ c.62.1.1 (Y:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]}
rafdlyfvldksgsvannwieiynfvqqlaerfvspemrlsfivfssqatiilpltgdrg
kiskgledlkrvspvgetyiheglklaneqiqkagglktssiiialtdgkldglvpsyae
keakisrslgasvycvgvldfeqaqleriadskeqvfpvkggfqalkgii

SCOPe Domain Coordinates for d1t6by_:

Click to download the PDB-style file with coordinates for d1t6by_.
(The format of our PDB-style files is described here.)

Timeline for d1t6by_: