SCOPe 2.05: Domain d1t6by_: 1t6b Y:

Lineage for d1t6by_ (1t6b Y:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)

6. Protein Capillary morphogenesis protein 2 domain [102543] (1 species)
   Anthrax toxin receptor 2

7. Species Human (Homo sapiens) [TaxId:9606] [102544] (3 PDB entries)
   Uniprot P58335 41-210

8. Domain d1t6by_: 1t6b Y: [106557]
   Other proteins in same PDB: d1t6bx1, d1t6bx2
   complexed with ca, mn, na, pg4

Details for d1t6by_

PDB Entry: 1t6b, 2.5 Å

PDB Description: Crystal structure of B. anthracis Protective Antigen complexed with human Anthrax toxin receptor

PDB Compounds: (Y:) Anthrax toxin receptor 2

SCOPe Domain Sequences for d1t6by_:

Sequence; same for both SEQRES and ATOM records:

>d1t6by_ c.62.1.1 (Y:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]}
rafdlyfvldksgsvannwieiynfvqqlaerfvspemrlsfivfssqatiilpltgdrg
kiskgledlkrvspvgetyiheglklaneqiqkagglktssiiialtdgkldglvpsyae
keakisrslgasvycvgvldfeqaqleriadskeqvfpvkggfqalkgii

Timeline for d1t6by_:

• d1t6by_ first appeared in SCOP 1.69
  
• d1t6by_ appears in SCOPe 2.04
  
• d1t6by_ appears in SCOPe 2.06
  
• d1t6by_ appears in the current release, SCOPe 2.08