![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
![]() | Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) |
![]() | Protein Capillary morphogenesis protein 2 domain [102543] (1 species) Anthrax toxin receptor 2 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102544] (3 PDB entries) Uniprot P58335 41-210 |
![]() | Domain d1t6by_: 1t6b Y: [106557] Other proteins in same PDB: d1t6bx1, d1t6bx2 complexed with ca, mn, na, pg4 |
PDB Entry: 1t6b (more details), 2.5 Å
SCOPe Domain Sequences for d1t6by_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6by_ c.62.1.1 (Y:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} rafdlyfvldksgsvannwieiynfvqqlaerfvspemrlsfivfssqatiilpltgdrg kiskgledlkrvspvgetyiheglklaneqiqkagglktssiiialtdgkldglvpsyae keakisrslgasvycvgvldfeqaqleriadskeqvfpvkggfqalkgii
Timeline for d1t6by_: