Lineage for d1t6bx2 (1t6b X:16-225)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2078445Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 2078446Superfamily b.179.1: PA14-like [254123] (3 families) (S)
  5. 2078447Family b.179.1.1: PA14 [254147] (2 protein domains)
    Pfam PF07691
  6. 2078458Protein PA14 [254334] (1 species)
  7. 2078459Species Bacillus anthracis [254763] (15 PDB entries)
  8. 2078471Domain d1t6bx2: 1t6b X:16-225 [238541]
    Other proteins in same PDB: d1t6bx1, d1t6by_
    complexed with ca, mn, na, pg4

Details for d1t6bx2

PDB Entry: 1t6b (more details), 2.5 Å

PDB Description: Crystal structure of B. anthracis Protective Antigen complexed with human Anthrax toxin receptor
PDB Compounds: (X:) Protective antigen

SCOPe Domain Sequences for d1t6bx2:

Sequence, based on SEQRES records: (download)

>d1t6bx2 b.179.1.1 (X:16-225) PA14 {Bacillus anthracis}
sqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkksd
eytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqyqrenptekgldfkly
wtdsqnkkevissdnlqlpelkqkssnsrkkrstsagptvpdrdndgipdslevegytvd
vknkrtflspwisnihekkgltkyksspek

Sequence, based on observed residues (ATOM records): (download)

>d1t6bx2 b.179.1.1 (X:16-225) PA14 {Bacillus anthracis}
sqgllgyyfsdlnfqapmvvtssttgdlsipsselenipsenqyfqsaiwsgfikvkksd
eytfatsadnhvtmwvddqevinkasnsnkirlekgrlyqikiqyqrenptekgldfkly
wtdsqnkkevissdnlqlpelkqvpdrdndgipdslevegytvdvknkrtflspwisnih
ekkgltkyksspek

SCOPe Domain Coordinates for d1t6bx2:

Click to download the PDB-style file with coordinates for d1t6bx2.
(The format of our PDB-style files is described here.)

Timeline for d1t6bx2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t6bx1
View in 3D
Domains from other chains:
(mouse over for more information)
d1t6by_