Lineage for d1t6bx1 (1t6b X:226-735)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2581113Fold f.60: Anthrax protective antigen C-terminal-like [254103] (1 superfamily)
    C-terminal 3 domains; II (226-487) is beta-sandwiches of gamma-crystallin like topology, similar to domain I; III (488-594) has a beta-grasp like fold; IV (595-735) has an Ig-like fold
  4. 2581114Superfamily f.60.1: Anthrax protective antigen C-terminal-like [254122] (1 family) (S)
  5. 2581115Family f.60.1.1: Anthrax protective antigen C-terminal-like [254146] (2 proteins)
  6. 2581116Protein Anthrax protective antigen C-terminal-like [254333] (1 species)
  7. 2581117Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [254762] (14 PDB entries)
  8. 2581129Domain d1t6bx1: 1t6b X:226-735 [238540]
    Other proteins in same PDB: d1t6bx2, d1t6by_
    complexed with ca, mn, na, pg4

Details for d1t6bx1

PDB Entry: 1t6b (more details), 2.5 Å

PDB Description: Crystal structure of B. anthracis Protective Antigen complexed with human Anthrax toxin receptor
PDB Compounds: (X:) Protective antigen

SCOPe Domain Sequences for d1t6bx1:

Sequence, based on SEQRES records: (download)

>d1t6bx1 f.60.1.1 (X:226-735) Anthrax protective antigen C-terminal-like {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
wstasdpysdfekvtgridknvspearhplvaaypivhvdmeniilsknedqstqntdsq
trtiskntstsrthtsevhgnaevhasffdiggsvsagfsnsnsstvaidhslslagert
waetmglntadtarlnaniryvntgtapiynvlpttslvlgknqtlatikakenqlsqil
apnnyypsknlapialnaqddfsstpitmnynqflelektkqlrldtdqvygniatynfe
ngrvrvdtgsnwsevlpqiqettariifngkdlnlverriaavnpsdplettkpdmtlke
alkiafgfnepngnlqyqgkditefdfnfdqqtsqniknqlaelnatniytvldkiklna
kmnilirdkrfhydrnniavgadesvvkeahrevinssteglllnidkdirkilsgyive
iedteglkevindrydmlnisslrqdgktfidfkkyndklplyisnpnykvnvyavtken
tiinpsengdtstngikkilifskkgyeig

Sequence, based on observed residues (ATOM records): (download)

>d1t6bx1 f.60.1.1 (X:226-735) Anthrax protective antigen C-terminal-like {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
wstasdpysdfekvtgridknvspearhplvaaypivhvdmeniilsknetiskntstsr
thtsevvsagfsnsnsstvaidhslslagertwaetmglntadtarlnaniryvntgtap
iynvlpttslvlgknqtlatikakenqlsqilapnnyypsknlapialnaqddfsstpit
mnynqflelektkqlrldtdqvygniatynfengrvrvdtgsnwsevlpqiqettariif
ngkdlnlverriaavnpsdplettkpdmtlkealkiafgfnepngnlqyqgkditefdfn
fdqqtsqniknqlaelnatniytvldkiklnakmnilirdkrfhydrnniavgadesvvk
eahrevinssteglllnidkdirkilsgyiveiedteglkevindrydmlnisslrqdgk
tfidfkkyndklplyisnpnykvnvyavtkentiinpsengdtstngikkilifskkgye
ig

SCOPe Domain Coordinates for d1t6bx1:

Click to download the PDB-style file with coordinates for d1t6bx1.
(The format of our PDB-style files is described here.)

Timeline for d1t6bx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t6bx2
View in 3D
Domains from other chains:
(mouse over for more information)
d1t6by_