SCOPe 2.07: Domain d1t62b1: 1t62 B:2001-2156

Lineage for d1t62b1 (1t62 B:2001-2156)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.4: Hypothetical protein EF3133 [110339] (1 protein)
   Pfam PF06171; DUF984

6. Protein Hypothetical protein EF3133 [110340] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [110341] (1 PDB entry)
   Uniprot Q82ZD1

8. Domain d1t62b1: 1t62 B:2001-2156 [106542]
   Other proteins in same PDB: d1t62a2, d1t62b2
   Structural genomics target

Details for d1t62b1

PDB Entry: 1t62, 3 Å

PDB Description: crystal structure of protein ef3133 from enterococcus faecalis v583, pfam duf984

PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d1t62b1:

Sequence, based on SEQRES records:

>d1t62b1 b.122.1.4 (B:2001-2156) Hypothetical protein EF3133 {Enterococcus faecalis [TaxId: 1351]}
mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegegdltldywyeeh
arffkeelapyqlqfypdmllvcqsfevvdlyteke

Sequence, based on observed residues (ATOM records):

>d1t62b1 b.122.1.4 (B:2001-2156) Hypothetical protein EF3133 {Enterococcus faecalis [TaxId: 1351]}
mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegltldywyeeharf
fkeelapyqlqfypdmllvcqsfevvdlyteke

Timeline for d1t62b1:

• d1t62b1 first appeared in SCOP 1.69, called d1t62b_
  
• d1t62b1 appears in SCOPe 2.06
  
• d1t62b1 appears in the current release, SCOPe 2.08