SCOP 1.69: Domain d1t62b_: 1t62 B:

Lineage for d1t62b_ (1t62 B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (4 families)

5. Family b.122.1.4: Hypothetical protein EF3133 [110339] (1 protein)
   DUF984: Pfam 06171

6. Protein Hypothetical protein EF3133 [110340] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [110341] (1 PDB entry)

8. Domain d1t62b_: 1t62 B: [106542]
   Structural genomics target

Details for d1t62b_

PDB Entry: 1t62, 3 Å

PDB Description: crystal structure of protein ef3133 from enterococcus faecalis v583, pfam duf984

SCOP Domain Sequences for d1t62b_:

Sequence, based on SEQRES records:

>d1t62b_ b.122.1.4 (B:) Hypothetical protein EF3133 {Enterococcus faecalis}
mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegegdltldywyeeh
arffkeelapyqlqfypdmllvcqsfevvdlytekeeggshhhhhh

Sequence, based on observed residues (ATOM records):

>d1t62b_ b.122.1.4 (B:) Hypothetical protein EF3133 {Enterococcus faecalis}
mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm
eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegltldywyeeharf
fkeelapyqlqfypdmllvcqsfevvdlytekeeggshhhhhh

Timeline for d1t62b_:

• d1t62b_ is new in SCOP 1.69
  
• d1t62b_ appears in SCOP 1.71
  
• d1t62b_ appears in the current release, SCOPe 2.08, called d1t62b1