![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (15 families) ![]() |
![]() | Family b.122.1.4: Hypothetical protein EF3133 [110339] (1 protein) Pfam PF06171; DUF984 |
![]() | Protein Hypothetical protein EF3133 [110340] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [110341] (1 PDB entry) Uniprot Q82ZD1 |
![]() | Domain d1t62b1: 1t62 B:2001-2156 [106542] Other proteins in same PDB: d1t62a2, d1t62b2 Structural genomics target |
PDB Entry: 1t62 (more details), 3 Å
SCOPe Domain Sequences for d1t62b1:
Sequence, based on SEQRES records: (download)
>d1t62b1 b.122.1.4 (B:2001-2156) Hypothetical protein EF3133 {Enterococcus faecalis [TaxId: 1351]} mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegegdltldywyeeh arffkeelapyqlqfypdmllvcqsfevvdlyteke
>d1t62b1 b.122.1.4 (B:2001-2156) Hypothetical protein EF3133 {Enterococcus faecalis [TaxId: 1351]} mlknvevfwqnfldkheldmlmpdvwmfgdgssemgnrlgqlvvsgrktatcssldiykm eeeqlpkagqydiildgqsqplaiirttkveimpmnkvsesfaqaegltldywyeeharf fkeelapyqlqfypdmllvcqsfevvdlyteke
Timeline for d1t62b1: