Lineage for d1t44g_ (1t44 G:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries)
    Uniprot P20065 55-179
  8. Domain d1t44g_: 1t44 G: [106395]
    Other proteins in same PDB: d1t44a1, d1t44a2
    complexed with atp, ca

Details for d1t44g_

PDB Entry: 1t44 (more details), 2 Å

PDB Description: structural basis of actin sequestration by thymosin-b4: implications for arp2/3 activation
PDB Compounds: (G:) Chimera of Gelsolin domain 1 and C-Terminal domain of thymosin Beta-4

SCOPe Domain Sequences for d1t44g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t44g_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
ehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhy
wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvas
gfkhvetqeknplpsketieqekq

SCOPe Domain Coordinates for d1t44g_ are not available.

Timeline for d1t44g_:

Domains from other chains:
(mouse over for more information)
d1t44a1, d1t44a2