![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
![]() | Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
![]() | Protein Gelsolin [55759] (2 species) consists of six similar domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries) Uniprot P20065 55-179 |
![]() | Domain d1t44g_: 1t44 G: [106395] Other proteins in same PDB: d1t44a1, d1t44a2 complexed with atp, ca |
PDB Entry: 1t44 (more details), 2 Å
SCOPe Domain Sequences for d1t44g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t44g_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} ehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhy wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvas gfkhvetqeknplpsketieqekq
Timeline for d1t44g_: