Lineage for d1t44g_ (1t44 G:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509537Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 509538Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 509539Family d.109.1.1: Gelsolin-like [55754] (4 proteins)
  6. 509540Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 509557Species Human (Homo sapiens) [TaxId:9606] [55761] (18 PDB entries)
  8. 509560Domain d1t44g_: 1t44 G: [106395]
    Other proteins in same PDB: d1t44a1, d1t44a2

Details for d1t44g_

PDB Entry: 1t44 (more details), 2 Å

PDB Description: structural basis of actin sequestration by thymosin-b4: implications for arp2/3 activation

SCOP Domain Sequences for d1t44g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t44g_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens)}
ehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhy
wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvas
gfkhvetqeknplpsketieqekq

SCOP Domain Coordinates for d1t44g_:

Click to download the PDB-style file with coordinates for d1t44g_.
(The format of our PDB-style files is described here.)

Timeline for d1t44g_: