![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein Actin [53073] (10 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries) Uniprot P02568 ! SQ 02568 |
![]() | Domain d1t44a1: 1t44 A:6-146 [106393] Other proteins in same PDB: d1t44g_ complexed with atp, ca |
PDB Entry: 1t44 (more details), 2 Å
SCOPe Domain Sequences for d1t44a1:
Sequence, based on SEQRES records: (download)
>d1t44a1 c.55.1.1 (A:6-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} talvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgil tlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfe tfnvpamyvaiqavlslyasg
>d1t44a1 c.55.1.1 (A:6-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} talvcdngsglvkagfagddapravfpsivgrpdsyvgdeaqskrgiltlkypiehgiit nwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyvaiq avlslyasg
Timeline for d1t44a1: