SCOPe 2.08: Domain d1t33b2: 1t33 B:89-220

Lineage for d1t33b2 (1t33 B:89-220)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Putative transcriptional repressor YbiH [109982] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [109983] (1 PDB entry)
   Uniprot Q8ZQN9

8. Domain d1t33b2: 1t33 B:89-220 [106298]
   Other proteins in same PDB: d1t33a1, d1t33b1
   Structural genomics target

Details for d1t33b2

PDB Entry: 1t33, 2.2 Å

PDB Description: Structural Genomics, The crystal structure of a putative transcriptional repressor (TetR/AcrR family) from Salmonella typhimurim LT2

PDB Compounds: (B:) putative transcriptional repressor (TetR/AcrR family)

SCOPe Domain Sequences for d1t33b2:

Sequence; same for both SEQRES and ATOM records:

>d1t33b2 a.121.1.1 (B:89-220) Putative transcriptional repressor YbiH {Salmonella typhimurium [TaxId: 90371]}
apdrdairelillacknmimlltqedtvnlskfisreqlsptsayqlvheqvidplhthl
trlvaaytgcdandtrmilhthallgevlafrlgketillrtgwpqfdeekaeliyqtvt
chidlilhgltq

Timeline for d1t33b2:

• d1t33b2 first appeared in SCOP 1.69
  
• d1t33b2 appears in SCOPe 2.07