Lineage for d1t33b2 (1t33 B:89-220)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2340898Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2340899Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2340900Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2341166Protein Putative transcriptional repressor YbiH [109982] (1 species)
  7. 2341167Species Salmonella typhimurium [TaxId:90371] [109983] (1 PDB entry)
    Uniprot Q8ZQN9
  8. 2341169Domain d1t33b2: 1t33 B:89-220 [106298]
    Other proteins in same PDB: d1t33a1, d1t33b1
    Structural genomics target

Details for d1t33b2

PDB Entry: 1t33 (more details), 2.2 Å

PDB Description: Structural Genomics, The crystal structure of a putative transcriptional repressor (TetR/AcrR family) from Salmonella typhimurim LT2
PDB Compounds: (B:) putative transcriptional repressor (TetR/AcrR family)

SCOPe Domain Sequences for d1t33b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t33b2 a.121.1.1 (B:89-220) Putative transcriptional repressor YbiH {Salmonella typhimurium [TaxId: 90371]}
apdrdairelillacknmimlltqedtvnlskfisreqlsptsayqlvheqvidplhthl
trlvaaytgcdandtrmilhthallgevlafrlgketillrtgwpqfdeekaeliyqtvt
chidlilhgltq

SCOPe Domain Coordinates for d1t33b2:

Click to download the PDB-style file with coordinates for d1t33b2.
(The format of our PDB-style files is described here.)

Timeline for d1t33b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t33b1