Lineage for d1t33b2 (1t33 B:89-220)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 447981Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 447982Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 447983Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (9 proteins)
  6. 448057Protein Putative transcriptional repressor YbiH [109982] (1 species)
  7. 448058Species Salmonella typhimurium [TaxId:90371] [109983] (1 PDB entry)
  8. 448060Domain d1t33b2: 1t33 B:89-220 [106298]
    Other proteins in same PDB: d1t33a1, d1t33b1
    Structural genomics target

Details for d1t33b2

PDB Entry: 1t33 (more details), 2.2 Å

PDB Description: Structural Genomics, The crystal structure of a putative transcriptional repressor (TetR/AcrR family) from Salmonella typhimurim LT2

SCOP Domain Sequences for d1t33b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t33b2 a.121.1.1 (B:89-220) Putative transcriptional repressor YbiH {Salmonella typhimurium}
apdrdairelillacknmimlltqedtvnlskfisreqlsptsayqlvheqvidplhthl
trlvaaytgcdandtrmilhthallgevlafrlgketillrtgwpqfdeekaeliyqtvt
chidlilhgltq

SCOP Domain Coordinates for d1t33b2:

Click to download the PDB-style file with coordinates for d1t33b2.
(The format of our PDB-style files is described here.)

Timeline for d1t33b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t33b1