SCOPe 2.06: Domain d1t33b1: 1t33 B:7-88

Lineage for d1t33b1 (1t33 B:7-88)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Putative transcriptional repressor YbiH [109655] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [109656] (1 PDB entry)
   Uniprot Q8ZQN9

8. Domain d1t33b1: 1t33 B:7-88 [106297]
   Other proteins in same PDB: d1t33a2, d1t33b2
   Structural genomics target

Details for d1t33b1

PDB Entry: 1t33, 2.2 Å

PDB Description: Structural Genomics, The crystal structure of a putative transcriptional repressor (TetR/AcrR family) from Salmonella typhimurim LT2

PDB Compounds: (B:) putative transcriptional repressor (TetR/AcrR family)

SCOPe Domain Sequences for d1t33b1:

Sequence; same for both SEQRES and ATOM records:

>d1t33b1 a.4.1.9 (B:7-88) Putative transcriptional repressor YbiH {Salmonella typhimurium [TaxId: 90371]}
ttkgeqaksqliaaalaqfgeyglhattrdiaalagqniaaityyfgskedlylacaqwi
adflgekfrphaekaerlfsqp

Timeline for d1t33b1:

• d1t33b1 first appeared in SCOP 1.69
  
• d1t33b1 appears in SCOPe 2.05
  
• d1t33b1 appears in SCOPe 2.07
  
• d1t33b1 appears in the current release, SCOPe 2.08