Lineage for d1t33b1 (1t33 B:7-88)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305653Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2305887Protein Putative transcriptional repressor YbiH [109655] (1 species)
  7. 2305888Species Salmonella typhimurium [TaxId:90371] [109656] (1 PDB entry)
    Uniprot Q8ZQN9
  8. 2305890Domain d1t33b1: 1t33 B:7-88 [106297]
    Other proteins in same PDB: d1t33a2, d1t33b2
    Structural genomics target

Details for d1t33b1

PDB Entry: 1t33 (more details), 2.2 Å

PDB Description: Structural Genomics, The crystal structure of a putative transcriptional repressor (TetR/AcrR family) from Salmonella typhimurim LT2
PDB Compounds: (B:) putative transcriptional repressor (TetR/AcrR family)

SCOPe Domain Sequences for d1t33b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t33b1 a.4.1.9 (B:7-88) Putative transcriptional repressor YbiH {Salmonella typhimurium [TaxId: 90371]}
ttkgeqaksqliaaalaqfgeyglhattrdiaalagqniaaityyfgskedlylacaqwi
adflgekfrphaekaerlfsqp

SCOPe Domain Coordinates for d1t33b1:

Click to download the PDB-style file with coordinates for d1t33b1.
(The format of our PDB-style files is described here.)

Timeline for d1t33b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t33b2