PDB entry 1t33

View 1t33 on RCSB PDB site
Description: Structural Genomics, The crystal structure of a putative transcriptional repressor (TetR/AcrR family) from Salmonella typhimurim LT2
Class: transcription
Keywords: Structural genomics, transcriptional repressor, TetR/CcrR family, Helix turn helix DNA binding domain, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSCRIPTION
Deposited on 2004-04-23, released 2004-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative transcriptional repressor (TetR/AcrR family)
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ybiH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1t33a1, d1t33a2
  • Chain 'B':
    Compound: putative transcriptional repressor (TetR/AcrR family)
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ybiH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1t33b1, d1t33b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t33A (A:)
    mnipttttkgeqaksqliaaalaqfgeyglhattrdiaalagqniaaityyfgskedlyl
    acaqwiadflgekfrphaekaerlfsqpapdrdairelillacknmimlltqedtvnlsk
    fisreqlsptsayqlvheqvidplhthltrlvaaytgcdandtrmilhthallgevlafr
    lgketillrtgwpqfdeekaeliyqtvtchidlilhgltqrsld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t33A (A:)
    mnipttttkgeqaksqliaaalaqfgeyglhattrdiaalagqniaaityyfgskedlyl
    acaqwiadflgekfrphaekaerlfsqpapdrdairelillacknmimlltqedtvnlsk
    fisreqlsptsayqlvheqvidplhthltrlvaaytgcdandtrmilhthallgevlafr
    lgketillrtgwpqfdeekaeliyqtvtchidlilhgltq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t33B (B:)
    mnipttttkgeqaksqliaaalaqfgeyglhattrdiaalagqniaaityyfgskedlyl
    acaqwiadflgekfrphaekaerlfsqpapdrdairelillacknmimlltqedtvnlsk
    fisreqlsptsayqlvheqvidplhthltrlvaaytgcdandtrmilhthallgevlafr
    lgketillrtgwpqfdeekaeliyqtvtchidlilhgltqrsld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t33B (B:)
    ttkgeqaksqliaaalaqfgeyglhattrdiaalagqniaaityyfgskedlylacaqwi
    adflgekfrphaekaerlfsqpapdrdairelillacknmimlltqedtvnlskfisreq
    lsptsayqlvheqvidplhthltrlvaaytgcdandtrmilhthallgevlafrlgketi
    llrtgwpqfdeekaeliyqtvtchidlilhgltq