Lineage for d1t2xa2 (1t2x A:1-150)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774102Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)
    automatically mapped to Pfam PF00754
  6. 2774103Protein Galactose oxidase, N-terminal domain [49787] (3 species)
  7. 2774108Species Fungus (Fusarium sp.) [TaxId:29916] [69209] (2 PDB entries)
    sequence identical to that of Dactylium dendroides
  8. 2774110Domain d1t2xa2: 1t2x A:1-150 [106293]
    Other proteins in same PDB: d1t2xa1, d1t2xa3
    complexed with act, cu, na; mutant

Details for d1t2xa2

PDB Entry: 1t2x (more details), 2.3 Å

PDB Description: Glactose oxidase C383S mutant identified by directed evolution
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d1t2xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2xa2 b.18.1.1 (A:1-150) Galactose oxidase, N-terminal domain {Fungus (Fusarium sp.) [TaxId: 29916]}
asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
aryvrlvaiteangqpwtsiaeinvfqass

SCOPe Domain Coordinates for d1t2xa2:

Click to download the PDB-style file with coordinates for d1t2xa2.
(The format of our PDB-style files is described here.)

Timeline for d1t2xa2: