Lineage for d1t2xa3 (1t2x A:151-537)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808720Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families) (S)
  5. 2808721Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins)
  6. 2808722Protein Galactose oxidase, central domain [50967] (3 species)
    N-terminal domain is a jelly-roll sandwich
    C-terminal domain is Immunoglobulin-like
  7. 2808723Species Dactylium dendroides [TaxId:5132] [50968] (4 PDB entries)
    Uniprot Q01745 42-680
  8. 2808725Domain d1t2xa3: 1t2x A:151-537 [106294]
    Other proteins in same PDB: d1t2xa1, d1t2xa2
    complexed with act, cu, na; mutant

Details for d1t2xa3

PDB Entry: 1t2x (more details), 2.3 Å

PDB Description: Glactose oxidase C383S mutant identified by directed evolution
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d1t2xa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2xa3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Dactylium dendroides [TaxId: 5132]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamsgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

SCOPe Domain Coordinates for d1t2xa3:

Click to download the PDB-style file with coordinates for d1t2xa3.
(The format of our PDB-style files is described here.)

Timeline for d1t2xa3: