Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Galactose oxidase, C-terminal domain [49209] (3 species) follows the catalytic seven-bladed beta-propeller domain |
Species Fungus (Fusarium sp.) [TaxId:29916] [69164] (2 PDB entries) sequence identical to that of Dactylium dendroides |
Domain d1t2xa1: 1t2x A:538-639 [106292] Other proteins in same PDB: d1t2xa2, d1t2xa3 complexed with act, cu, na; mutant |
PDB Entry: 1t2x (more details), 2.3 Å
SCOPe Domain Sequences for d1t2xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t2xa1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Fungus (Fusarium sp.) [TaxId: 29916]} gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq
Timeline for d1t2xa1: