Lineage for d1t2xa1 (1t2x A:538-639)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765186Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2765311Protein Galactose oxidase, C-terminal domain [49209] (3 species)
    follows the catalytic seven-bladed beta-propeller domain
  7. 2765316Species Fungus (Fusarium sp.) [TaxId:29916] [69164] (2 PDB entries)
    sequence identical to that of Dactylium dendroides
  8. 2765318Domain d1t2xa1: 1t2x A:538-639 [106292]
    Other proteins in same PDB: d1t2xa2, d1t2xa3
    complexed with act, cu, na; mutant

Details for d1t2xa1

PDB Entry: 1t2x (more details), 2.3 Å

PDB Description: Glactose oxidase C383S mutant identified by directed evolution
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d1t2xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t2xa1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Fungus (Fusarium sp.) [TaxId: 29916]}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

SCOPe Domain Coordinates for d1t2xa1:

Click to download the PDB-style file with coordinates for d1t2xa1.
(The format of our PDB-style files is described here.)

Timeline for d1t2xa1: