Lineage for d1t0lc_ (1t0l C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1182016Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1182017Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1182018Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 1182106Protein NADP-dependent isocitrate dehydrogenase [82524] (2 species)
  7. 1182107Species Human (Homo sapiens) [TaxId:9606] [110715] (2 PDB entries)
    Uniprot O75874
  8. 1182110Domain d1t0lc_: 1t0l C: [106218]
    complexed with ca, ict, nap

Details for d1t0lc_

PDB Entry: 1t0l (more details), 2.41 Å

PDB Description: Crystal structure of human cytosolic NADP(+)-dependent isocitrate dehydrogenase in complex with NADP, isocitrate, and calcium(2+)
PDB Compounds: (C:) isocitrate dehydrogenase [nadp] cytoplasmic

SCOPe Domain Sequences for d1t0lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0lc_ c.77.1.1 (C:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
mskkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkda
aeaikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprl
vsgwvkpiiigrhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvam
gmynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfe
aqkiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdg
ktveaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanale
evsietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl

SCOPe Domain Coordinates for d1t0lc_:

Click to download the PDB-style file with coordinates for d1t0lc_.
(The format of our PDB-style files is described here.)

Timeline for d1t0lc_: